PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00078.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 312aa    MW: 35571.7 Da    PI: 6.9583
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00078.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.9e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l++ ++++G g+W++ ++  g++R++k+c++rw +yl
  Rsa1.0_00078.1_g00003.1 14 KGPWTPEEDQKLINHIQKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding57.43.3e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T+eE++ +++++ +lG++ W++Ia +++ gRt++++k++w+++
  Rsa1.0_00078.1_g00003.1  67 RGNFTAEEEQTIINLHSLLGNK-WSSIAGHLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.484961IPR017930Myb domain
SuperFamilySSF466896.6E-3311108IPR009057Homeodomain-like
SMARTSM007178.5E-161363IPR001005SANT/Myb domain
PfamPF002491.1E-171461IPR001005SANT/Myb domain
CDDcd001672.72E-121661No hitNo description
PROSITE profilePS5129427.39462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2865117IPR009057Homeodomain-like
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.9E-1667111IPR001005SANT/Myb domain
CDDcd001677.66E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLINHIQ KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TAEEEQTIIN LHSLLGNKWS SIAGHLPGRT DNEIKNYWNT HIRKKLIQMG  120
IDPVTHRPRT DHLNVLAALP QLLAAANFNN LLTLNQNIQP DATSIAKAQW LHSMMQVLNN  180
NNNNNTSSSS IDIHNTNNYI FGQSSFIENQ PNISENFYDP TQSLSHIDHQ PMDSFSSPFR  240
VFSHQDIVPP LISASPDESK QTQMMIKNKE ILKHNEHTSN PSSTPTFAQD HQPWCDIIDD  300
EATDSYWKDI IE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584940.10.0PREDICTED: myb-related protein 330-like
TrEMBLA0A0D3CN560.0A0A0D3CN56_BRAOL; Uncharacterized protein
STRINGBra032028.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.11e-167myb domain protein 107